Return to main results Retrieve Phyre Job Id

Job DescriptionP77231
Confidence2.55%DateThu Jan 5 12:26:37 GMT 2012
Rank70Aligned Residues28
% Identity29%Templatec2bf9A_
PDB info PDB header:hormoneChain: A: PDB Molecule:pancreatic hormone; PDBTitle: anisotropic refinement of avian (turkey) pancreatic2 polypeptide at 0.99 angstroms resolution.
Resolution0.99 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   35....40.........50.........60.........
Predicted Secondary structure 



















Query SS confidence 


































Query Sequence  LSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWL
Query Conservation    






    
 
 

    

 

 

 
 
Alig confidence 






.....

..


















Template Conservation   
 

  .....

..
 
 

 

 
  


 

Template Sequence  GPSQPTY. . . . . PG. . DDAPVEDLIRFYNDLQQYL
Template Known Secondary structure 






.....

..TTS
Template Predicted Secondary structure 






.....

..



Template SS confidence 


































   1...... .. 10.........20........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions