Return to main results Retrieve Phyre Job Id

Job DescriptionP32151
Confidence5.47%DateThu Jan 5 11:49:31 GMT 2012
Rank54Aligned Residues35
% Identity23%Templatec3mtuE_
PDB info PDB header:contractile proteinChain: E: PDB Molecule:head morphogenesis protein, tropomyosin alpha-1 chain; PDBTitle: structure of the tropomyosin overlap complex from chicken smooth2 muscle
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   304.....310.........320.........330.........340.........350
Predicted Secondary structure 

















Query SS confidence 














































Query Sequence  RRIRDKVPYSDWDKEQLQDANSSWMVEDSFPRALREYNEMVDDYNSL
Query Conservation 



     
  
   
          

   

  

 

  

  
Alig confidence 
















............

















Template Conservation 
 




 

 




 ............




  


  

   
Template Sequence  EDILNKLLDPQSERTEA. . . . . . . . . . . . LQQLRVNYGSFVSEYNDL
Template Known Secondary structure  TT


............
Template Predicted Secondary structure 



............
Template SS confidence 














































   910.........20..... ....30.........40...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions