Return to main results Retrieve Phyre Job Id

Job DescriptionP77297
Confidence8.06%DateThu Jan 5 12:27:24 GMT 2012
Rank28Aligned Residues21
% Identity19%Templatec3u1nC_
PDB info PDB header:hydrolaseChain: C: PDB Molecule:sam domain and hd domain-containing protein 1; PDBTitle: structure of the catalytic core of human samhd1
Resolution3.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10...... ...20.......
Predicted Secondary structure 



............


Query SS confidence 









. . . . . . . . . . . .










Query Sequence  DADFLAQRGQ. . . . . . . . . . . . GQVEQVFARAV
Query Conservation 
   
     ............
 




  

Alig confidence 









............










Template Conservation 


 




 




    




 







Template Sequence  DTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSL
Template Known Secondary structure  SSGGGGSBTTGGGTTT
TT


B
Template Predicted Secondary structure 


















Template SS confidence 
































   137..140.........150.........160.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions