Return to main results Retrieve Phyre Job Id

Job DescriptionP77297
Confidence5.15%DateThu Jan 5 12:27:24 GMT 2012
Rank48Aligned Residues34
% Identity21%Templatec2j5dA_
PDB info PDB header:membrane proteinChain: A: PDB Molecule:bcl2/adenovirus e1b 19 kda protein-interacting PDBTitle: nmr structure of bnip3 transmembrane domain in lipid2 bicelles
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   228.230.........240.........250.........260.........270........
Predicted Secondary structure 











Query SS confidence 


















































Query Sequence  QRCRENIHRFIHNIIYDIPGNATQAIEKIKHIGSSSGCDMLYGMADGCALS
Query Conservation 
  
     
   
              

 





 
 
 

  

 
 
Alig confidence 











......
...










........









Template Conservation 











......
...

 







........









Template Sequence  GIFSAEFLKVFL. . . . . . P. . . SLLLSHLLAIG. . . . . . . . LGIYIGRRLT
Template Known Secondary structure  S
S
.................
Template Predicted Secondary structure 


.................
Template SS confidence 


















































   155....160...... . ..170........ .180........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions