Return to main results Retrieve Phyre Job Id

Job DescriptionP36662
Confidence3.96%DateThu Jan 5 11:53:34 GMT 2012
Rank57Aligned Residues25
% Identity20%Templatec3nnhA_
PDB info PDB header:rna binding protein/rnaChain: A: PDB Molecule:cugbp elav-like family member 1; PDBTitle: crystal structure of the cugbp1 rrm1 with guuguuuuguuu rna
Resolution2.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7980.........90.........100.........110..
Predicted Secondary structure 



















Query SS confidence 

































Query Sequence  CGLFLMTDKQAALPYASAYKQDEQEIKRLLVEAG
Query Conservation 
 

 

     




 
      
   
   
Alig confidence 












.........











Template Conservation    


 


   
.........
  
   
   
Template Sequence  IKMFVGQVPRTWS. . . . . . . . . EKDLRELFEQYG
Template Known Secondary structure 


TT

.........TTTS
Template Predicted Secondary structure 







.........

Template SS confidence 

































   16...20........ .30.........40
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions