Return to main results Retrieve Phyre Job Id

Job DescriptionP75948
Confidence73.36%DateThu Jan 5 12:16:18 GMT 2012
Rank211Aligned Residues25
% Identity24%Templatec3ek7A_
PDB info PDB header:fluorescent proteinChain: A: PDB Molecule:myosin light chain kinase, green fluorescent PDBTitle: calcium-saturated gcamp2 dimer
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   166...170.........180. .. ......190
Predicted Secondary structure 










............



Query SS confidence 















. . . .

. . . . . . . .






Query Sequence  LHMDVHAGNLVHSASG. . . . LK. . . . . . . . LIDWEYA
Query Conservation   



   


     ....  ........




 
Alig confidence 















....

........






Template Conservation   




 

            
          
 
  
Template Sequence  IGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQ
Template Known Secondary structure 



GGGTBTTS
Template Predicted Secondary structure 




























Template SS confidence 




































   54.....60.........70.........80.........90
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions