Return to main results Retrieve Phyre Job Id

Job DescriptionP0A700
Confidence20.53%DateThu Jan 5 11:04:19 GMT 2012
Rank222Aligned Residues27
% Identity22%Templatec3mwmA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:putative metal uptake regulation protein; PDBTitle: graded expression of zinc-responsive genes through two regulatory2 zinc-binding sites in zur
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   6970.........80...... ...90.....
Predicted Secondary structure 












.......................








Query SS confidence 

















. . . . . . . . . . . . . . . . . . . . . . .








Query Sequence  AECWCETCQQYVTLLTQR. . . . . . . . . . . . . . . . . . . . . . . VRRCPQCHG
Query Conservation      
  

         .......................   

 


Alig confidence 

















.......................








Template Conservation   
  
  

 
  
                

 
    
   
 
  
  
Template Sequence  HHLVCRACGKAVEVEGPAVEKWAEAIAAEHGYVNVAHTVEIFGTCADCAG
Template Known Secondary structure  TTT



TT

S







Template Predicted Secondary structure 












Template SS confidence 

















































   86...90.........100.........110.........120.........130.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions