Return to main results Retrieve Phyre Job Id

Job DescriptionP0A700
Confidence25.43%DateThu Jan 5 11:04:19 GMT 2012
Rank204Aligned Residues25
% Identity20%Templatec2xigA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:ferric uptake regulation protein; PDBTitle: the structure of the helicobacter pylori ferric uptake2 regulator fur reveals three functional metal binding sites
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   6970.........80...... ...90...
Predicted Secondary structure 












.......................






Query SS confidence 

















. . . . . . . . . . . . . . . . . . . . . . .






Query Sequence  AECWCETCQQYVTLLTQR. . . . . . . . . . . . . . . . . . . . . . . VRRCPQC
Query Conservation      
  

         .......................   

 
Alig confidence 

















.......................






Template Conservation   
 

  

 
       
           

 
    
   
 
  
Template Sequence  DHIICLHCGKIIEFADPEIENRQNEVVKKYQAKLISHDMKMFVWCKEC
Template Known Secondary structure  TTT



TTT









Template Predicted Secondary structure 












Template SS confidence 















































   98.100.........110.........120.........130.........140.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions