Return to main results Retrieve Phyre Job Id

Job DescriptionP0A700
Confidence44.34%DateThu Jan 5 11:04:19 GMT 2012
Rank123Aligned Residues24
% Identity21%Templatec2eozA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:zinc finger protein 473; PDBTitle: solution structure of the c2h2 type zinc finger (region 809-2 841) of human zinc finger protein 473
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   71........80...... ...90....
Predicted Secondary structure 












..........







Query SS confidence 















. . . . . . . . . .







Query Sequence  CWCETCQQYVTLLTQR. . . . . . . . . . VRRCPQCH
Query Conservation    
  

         ..........   

 

Alig confidence 















..........







Template Conservation    
  
 
 
     
  
 
 
      
  

Template Sequence  YSCNVCGKAFVLSAHLNQHLRVHTQETLSGPSSG
Template Known Secondary structure  TTTTSSSS

SSS



Template Predicted Secondary structure 






















Template SS confidence 

































   13......20.........30.........40......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions