Return to main results Retrieve Phyre Job Id

Job DescriptionP52125
Confidence9.11%DateThu Jan 5 12:05:28 GMT 2012
Rank13Aligned Residues31
% Identity19%Templatec3ugsB_
PDB info PDB header:transferaseChain: B: PDB Molecule:undecaprenyl pyrophosphate synthase; PDBTitle: crystal structure of a probable undecaprenyl diphosphate synthase2 (upps) from campylobacter jejuni
Resolution2.46 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   111........120.........130.........140.........150
Predicted Secondary structure 

















Query SS confidence 







































Query Sequence  HLILCFNQDAYYHLGDYDLNRNTLRTMITTAWYSALGIPI
Query Conservation 
  
 

       
        
   
  

  
     
Alig confidence 






.......













..









Template Conservation 






.......



 
   
  

.. 

   

  
Template Sequence  HLAVVMD. . . . . . . GNRSQGVKTMQKLM. . EVCMEENISN
Template Known Secondary structure 
.......



..TT

Template Predicted Secondary structure 
.......

..



Template SS confidence 







































   6...10.. .......20...... ...30......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions