Return to main results Retrieve Phyre Job Id

Job DescriptionP52125
Confidence4.26%DateThu Jan 5 12:05:28 GMT 2012
Rank33Aligned Residues21
% Identity38%Templatec3t4aG_
PDB info PDB header:immune systemChain: G: PDB Molecule:fibrinogen-binding protein; PDBTitle: structure of a truncated form of staphylococcal complement inhibitor b2 bound to human c3c at 3.4 angstrom resolution
Resolution3.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8.10.... .....20........
Predicted Secondary structure 



.............................
Query SS confidence 






. . . . . . . . . . . . . . . . . . . . . . . . . . . . .













Query Sequence  GSHVSLY. . . . . . . . . . . . . . . . . . . . . . . . . . . . . RDRIKQVIDDSLNE
Query Conservation        
.............................
  
   
   
  
Alig confidence 






.............................













Template Conservation 










 
 
 


 






 


 

  




 





  
Template Sequence  GSLNPYYKRTIMMNEYRAKAALKKNDFVSMADAKVALEKIYKEIDEIINR
Template Known Secondary structure  TSS
TTT

Template Predicted Secondary structure 





Template SS confidence 

















































   36...40.........50.........60.........70.........80.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions