Return to main results Retrieve Phyre Job Id

Job DescriptionP42589
Confidence1.57%DateThu Jan 5 12:01:36 GMT 2012
Rank85Aligned Residues54
% Identity20%Templatec1uijA_
PDB info PDB header:sugar binding proteinChain: A: PDB Molecule:beta subunit of beta conglycinin; PDBTitle: crystal structure of soybean beta-conglycinin beta2 homotrimer (i122m/k124w)
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910.........20.........30. ........40.........50.........60.........70.........80....
Predicted Secondary structure 






.




















Query SS confidence 






















.




















































Query Sequence  FARLEMRVGKIVEVKRHENADKL. YIVQVDVGQKTLQTVTSLVPYYSEEELMGKTVVVLCNLQKAKMRGETSECMLL
Query Conservation 
  


 

 
  
  

 



. 
  

 
     

           
 
  
    


  




 





Alig confidence 






















.



...









...................
















Template Conservation 
    
  


  



  
 

  
  ...
   



  ...................          
  
 
 
Template Sequence  LSSVDINEGALLLPHFNSKAIVILVINE. . . GDANIELVGI. . . . . . . . . . . . . . . . . . . KLEVQRYRAELSEDDVF
Template Known Secondary structure 
TTSS
...S...................


TT
Template Predicted Secondary structure 












...



...................






Template SS confidence 












































































   251........260.........270........ .280........ .290.........300.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions