Return to main results Retrieve Phyre Job Id

Job DescriptionP77689
Confidence7.48%DateThu Jan 5 12:31:40 GMT 2012
Rank100Aligned Residues28
% Identity29%Templatec2y96A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:dual specificity phosphatase dupd1; PDBTitle: structure of human dual-specificity phosphatase 27
Resolution2.38 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   372..... ..380.........390. ........
Predicted Secondary structure  .



........
Query SS confidence 





.













. . . . . . . .







Query Sequence  IFYLRS. RGINQQDAQQMIIY. . . . . . . . AFAAELTE
Query Conservation 



 
.


   

  


 ........

  


 
Alig confidence 





.













........







Template Conservation   



         
   

  
 
 

  
  

  
Template Sequence  LAYLMIHKDMTLVDAIQQVAKNRCVLPNRGFLKQLRE
Template Known Secondary structure  S


TTS




Template Predicted Secondary structure 









Template SS confidence 




































   159160.........170.........180.........190.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions