Return to main results Retrieve Phyre Job Id

Job DescriptionP76231
Confidence33.32%DateThu Jan 5 12:20:57 GMT 2012
Rank21Aligned Residues25
% Identity40%Templatec3edhA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:bone morphogenetic protein 1; PDBTitle: crystal structure of bone morphogenetic protein 1 protease2 domain in complex with partially bound dmso
Resolution1.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   26...30. ........40.........50
Predicted Secondary structure 





.......


Query SS confidence 





. . . . . . .


















Query Sequence  KWPDGV. . . . . . . ALTEEQKENCLQLVMLWQA
Query Conservation 




 ....... 

 



  




 

 
Alig confidence 





.......


















Template Conservation   

   
 
          
  
  

     
Template Sequence  VWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEK
Template Known Secondary structure  S
GGG
SS

Template Predicted Secondary structure 









Template SS confidence 































   910.........20.........30.........40
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions