Return to main results Retrieve Phyre Job Id

Job DescriptionP32154
Confidence20.82%DateThu Jan 5 11:49:34 GMT 2012
Rank148Aligned Residues43
% Identity16%Templatec2issF_
PDB info PDB header:lyase, transferaseChain: F: PDB Molecule:glutamine amidotransferase subunit pdxt; PDBTitle: structure of the plp synthase holoenzyme from thermotoga maritima
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20.........30.........40.........50.........60.....
Predicted Secondary structure 




















Query SS confidence 




























































Query Sequence  LRIVAITNCPAGIAHTYMVAEALEQKARSLGHTIKVETQGSSGVENRLSSEEIAAADYVIL
Query Conservation        


  




 


  
            

  
  
    
    
  
   
 
Alig confidence 

.






....


...

















..........












Template Conservation    .



   ....
  ...      
   
     
 ..........    
   




Template Sequence  MK. IGVLGVQ. . . . GDV. . . REHVEALHKLGVETLIVK. . . . . . . . . . LPEQLDMVDGLIL
Template Known Secondary structure 
.
SS....S
...TT

..........SGGGGGG
S
Template Predicted Secondary structure 
.
....

...



..........


Template SS confidence 




























































   1. ....... 10.. .......20.........30 .........40...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions