Return to main results Retrieve Phyre Job Id

Job DescriptionP46856
Confidence9.05%DateThu Jan 5 12:04:28 GMT 2012
Rank17Aligned Residues42
% Identity14%Templatec3lfmA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:protein fto; PDBTitle: crystal structure of the fat mass and obesity associated (fto) protein2 reveals basis for its substrate specificity
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   64.....70.........80.........90.........100.........110.........120..
Predicted Secondary structure 




























Query SS confidence 


























































Query Sequence  LTFLRAMDGFEVNGLRLFSLSIPEPSVKNLFAVNEFYRNNDDFINPDLQERLVIGDYSI
Query Conservation     
  


















 








  
 
 






  








Alig confidence 
































.................








Template Conservation    

 

  
   
 
 



    
   
 

.................
 


  
 
Template Sequence  KEVQEAFLTLHKHGCLFRDLVRIQGKDLLTPVS. . . . . . . . . . . . . . . . . RILIGNPGC
Template Known Secondary structure  TT

B


GGG


SS.................STTB
Template Predicted Secondary structure 











.................




Template SS confidence 


























































   63......70.........80.........90..... ....100....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions