Return to main results Retrieve Phyre Job Id

Job DescriptionP76182
Confidence7.67%DateThu Jan 5 12:20:12 GMT 2012
Rank6Aligned Residues25
% Identity24%Templatec3knuD_
PDB info PDB header:transferaseChain: D: PDB Molecule:trna (guanine-n(1)-)-methyltransferase; PDBTitle: crystal structure of trna (guanine-n1)-methyltransferase from2 anaplasma phagocytophilum
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   327..330......... 340.........350.
Predicted Secondary structure  .......









Query SS confidence 












. . . . . . .











Query Sequence  AVLLANITVPLID. . . . . . . YYTRPRVYGHRK
Query Conservation 





   



.......    
   
  
Alig confidence 












.......











Template Conservation 







 








 
 



    
  
Template Sequence  AMVIIDTCVRMVPGVILEYPQYTRPASWKGME
Template Known Secondary structure  TTSTTT







S
STT
Template Predicted Secondary structure 















Template SS confidence 































   144.....150.........160.........170.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions