Return to main results Retrieve Phyre Job Id

Job DescriptionP76182
Confidence4.21%DateThu Jan 5 12:20:12 GMT 2012
Rank18Aligned Residues25
% Identity32%Templatec1oy5B_
PDB info PDB header:transferaseChain: B: PDB Molecule:trna (guanine-n(1)-)-methyltransferase; PDBTitle: crystal structure of trna (m1g37) methyltransferase from aquifex2 aeolicus
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   327..330......... 340.........350.
Predicted Secondary structure  ........









Query SS confidence 












. . . . . . . .











Query Sequence  AVLLANITVPLID. . . . . . . . YYTRPRVYGHRK
Query Conservation 





   



........    
   
  
Alig confidence 












........











Template Conservation 







 









 
 



    
  
Template Sequence  ALAVIDAVSRVLPGVLSEPYPVYTRPREYRGMK
Template Known Secondary structure  STTTSS






S
STT
Template Predicted Secondary structure 



















Template SS confidence 
































   446...450.........460.........470........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions