Return to main results Retrieve Phyre Job Id

Job DescriptionP52143
Confidence4.01%DateWed Jan 25 15:20:58 GMT 2012
Rank85Aligned Residues24
% Identity25%Templatec1ezjA_
PDB info PDB header:viral protein, transferaseChain: A: PDB Molecule:nucleocapsid phosphoprotein; PDBTitle: crystal structure of the multimerization domain of the phosphoprotein2 from sendai virus
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.... .....20....
Predicted Secondary structure 





........
Query SS confidence 













. . . . . . . .









Query Sequence  MNRTSPYYCRRSVL. . . . . . . . SLLISALIYA
Query Conservation                ........          
Alig confidence 













........









Template Conservation   

 

 


 
 





 




 

   
Template Sequence  SSRDASYVFARRALKSANYAEMTFNVCGLILS
Template Known Secondary structure  T


T

S
Template Predicted Secondary structure 

Template SS confidence 































   28.30.........40.........50.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions