Return to main results Retrieve Phyre Job Id

Job DescriptionP0AE91
Confidence3.11%DateThu Jan 5 11:22:48 GMT 2012
Rank75Aligned Residues25
% Identity40%Templatec2wfoA_
PDB info PDB header:viral proteinChain: A: PDB Molecule:glycoprotein 1; PDBTitle: crystal structure of machupo virus envelope glycoprotein2 gp1
Resolution1.73 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   44.....50.........60.........70........
Predicted Secondary structure 
























Query SS confidence 


































Query Sequence  AFDDPDVKNVTCYVSRAKTGGIKGGLGLAEDTSDA
Query Conservation 
 


 
 






    

     
 




 
Alig confidence 














......
....








Template Conservation 
   

 

  
 
 ......
....     

  
Template Sequence  GFYDPCEEGKVCYVT. . . . . . I. . . . NQCGDPSSF
Template Known Secondary structure  T





BTS

..........TTSGGGT
Template Predicted Secondary structure 









..........








Template SS confidence 


































   202.......210...... . ..220......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions