Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABL3
Confidence25.27%DateThu Jan 5 11:15:46 GMT 2012
Rank60Aligned Residues19
% Identity47%Templatec3h34A_
PDB info PDB header:electron transportChain: A: PDB Molecule:cytochrome c7; PDBTitle: ppce, a cytochrome c7 from geobacter sulfurreducens
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   83......90.........100.........110.........120.......
Predicted Secondary structure 































Query SS confidence 












































Query Sequence  CLQCHGVESYRTTGAPRISPTHFMDSDGKVGAEVAPRRYFCLQCH
Query Conservation 

 

    
   

  

 


 

 
  
  











Alig confidence 




.....








.....................




Template Conservation 
  

.....     

  .....................
  

Template Sequence  CKGCH. . . . . EVRGAGPTK. . . . . . . . . . . . . . . . . . . . . CKLCH
Template Known Secondary structure  .....T
S

S.....................B
Template Predicted Secondary structure  .....





.....................


Template SS confidence 












































   51.... ....60.... .....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions