Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABL3
Confidence24.35%DateThu Jan 5 11:15:46 GMT 2012
Rank66Aligned Residues27
% Identity30%Templatec2yiuE_
PDB info PDB header:oxidoreductaseChain: E: PDB Molecule:cytochrome c1, heme protein; PDBTitle: x-ray structure of the dimeric cytochrome bc1 complex from2 the soil bacterium paracoccus denitrificans at 2.73 angstrom resolution
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   81........90.........100.........110.....
Predicted Secondary structure 


























Query SS confidence 


































Query Sequence  NRCLQCHGVESYRTTGAPRISPTHFMDSDGKVGAE
Query Conservation 
 

 

    
   

  

 


 

 
  
  
Alig confidence 










........















Template Conservation    
  



 
........ 

  
    
     
Template Sequence  EVCSACHGLRY. . . . . . . . VPLRTLADEGGPQLPE
Template Known Secondary structure  TTTT


TT........
BGGGGGSTTS



Template Predicted Secondary structure 



........






Template SS confidence 


































   80.........90 .........100......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions