Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABL3
Confidence58.56%DateThu Jan 5 11:15:46 GMT 2012
Rank23Aligned Residues37
% Identity27%Templatec2j7aC_
PDB info PDB header:oxidoreductaseChain: C: PDB Molecule:cytochrome c quinol dehydrogenase nrfh; PDBTitle: crystal structure of cytochrome c nitrite reductase nrfha2 complex from desulfovibrio vulgaris
Resolution2.3 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   83......90.........100.........110.........120....... ..130.........
Predicted Secondary structure 































..











Query SS confidence 












































. .











Query Sequence  CLQCHGVESYRTTGAPRISPTHFMDSDGKVGAEVAPRRYFCLQCH. . VPQADTAPIVGN
Query Conservation 

 

    
   

  

 


 

 
  
  











..


 

 


 
Alig confidence 















....................








..











Template Conservation 
  

  
        ....................    
  

 
  
         
Template Sequence  CKACHTMTNVEVASME. . . . . . . . . . . . . . . . . . . . AKKYCTDCHRNVQHMRMKPISTR
Template Known Secondary structure  TTS
TTT....................SSSSGGGTSGGGTTTTTS
GGGT
Template Predicted Secondary structure 







....................

















Template SS confidence 


























































   116...120.........130. ........140.........150....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions