Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABL3
Confidence59.98%DateThu Jan 5 11:15:46 GMT 2012
Rank21Aligned Residues25
% Identity36%Templatec2bq4A_
PDB info PDB header:electron transportChain: A: PDB Molecule:basic cytochrome c3; PDBTitle: crystal structure of type i cytochrome c3 from2 desulfovibrio africanus
Resolution1.68 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   82.......90.........100.........110.........120.......
Predicted Secondary structure 
































Query SS confidence 













































Query Sequence  RCLQCHGVESYRTTGAPRISPTHFMDSDGKVGAEVAPRRYFCLQCH
Query Conservation   

 

    
   

  

 


 

 
  
  











Alig confidence 



















.....................




Template Conservation 

  

          

  .....................
  

Template Sequence  SCQGCHKEMKTAKKTTGPTA. . . . . . . . . . . . . . . . . . . . . CAQCH
Template Known Secondary structure  SGGGT
S



S.....................
Template Predicted Secondary structure 









.....................

Template SS confidence 













































   8990.........100........ .110...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions