Return to main results Retrieve Phyre Job Id

Job DescriptionP76486
Confidence8.46%DateThu Jan 5 12:23:32 GMT 2012
Rank98Aligned Residues23
% Identity52%Templatec3h2zA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:mannitol-1-phosphate 5-dehydrogenase; PDBTitle: the crystal structure of mannitol-1-phosphate dehydrogenase from2 shigella flexneri
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   14.....20.........30.........40.........50.........60......
Predicted Secondary structure 

































Query SS confidence 




















































Query Sequence  IDGICPGPFPPNGFTVLTDAAYGNGDCFGLYWPIGQEHKLPIVCETYHDEWRI
Query Conservation 




















































Alig confidence 






.............................











.



Template Conservation 





 ............................. 
   
  
 
 . 


Template Sequence  VDRIVPP. . . . . . . . . . . . . . . . . . . . . . . . . . . . . NDPLEVTVETFS. EWIV
Template Known Secondary structure 




.............................

SS
S

.
Template Predicted Secondary structure 




.............................





.
Template SS confidence 




















































   157..160... ......170..... ....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions