Return to main results Retrieve Phyre Job Id

Job DescriptionP08321
Confidence5.05%DateThu Jan 5 11:01:04 GMT 2012
Rank22Aligned Residues37
% Identity32%Templatec1tlqA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:hypothetical protein ypjq; PDBTitle: crystal structure of protein ypjq from bacillus subtilis, pfam duf64
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   18.20.........30.........40.........50.........60.......
Predicted Secondary structure 





Query SS confidence 

















































Query Sequence  TNQSRWFGLPLDELIPAAICIGWGITTSKYLFGIGAAVLVYFGIKKLKKG
Query Conservation 
   

    


 

    
 


     


 



      



 
Alig confidence 






...














..........














Template Conservation   
     ...





  

 
 
 .......... 

  

 


 

 
Template Sequence  TDEPLYG. . . IDEIIPLSIVNVYGS. . . . . . . . . . IGLTNFGYLDKEKIG
Template Known Secondary structure  T
TT

...TTTT..........S

T
Template Predicted Secondary structure 



.............

Template SS confidence 

















































   91...... ..100.........110.. .......120.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions