Return to main results Retrieve Phyre Job Id

Job DescriptionP0AD03
Confidence61.25%DateThu Jan 5 11:19:33 GMT 2012
Rank86Aligned Residues32
% Identity25%Templatec3gn5B_
PDB info PDB header:dna binding proteinChain: B: PDB Molecule:hth-type transcriptional regulator mqsa (ygit/b3021); PDBTitle: structure of the e. coli protein mqsa (ygit/b3021)
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2930..... ....40..... ....50.........60
Predicted Secondary structure 




..





............








Query SS confidence 






. .









. . . . . . . . . . . .














Query Sequence  QRCPQCD. . MLFSLPEINS. . . . . . . . . . . . HQSAYCPRCQAKIRD
Query Conservation    
  

.. 
     
  ............
  
 




  
  
Alig confidence 






..









............














Template Conservation 



 

               

    
       
  


    
Template Sequence  MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMN
Template Known Secondary structure 
B
TTTSSSBTTTTT



Template Predicted Secondary structure 




















Template SS confidence 













































   1........10.........20.........30.........40......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions