Return to main results Retrieve Phyre Job Id

Job DescriptionP75898
Confidence34.16%DateThu Jan 5 12:15:49 GMT 2012
Rank37Aligned Residues32
% Identity9%Templatec3kwsB_
PDB info PDB header:isomeraseChain: B: PDB Molecule:putative sugar isomerase; PDBTitle: crystal structure of putative sugar isomerase (yp_001305149.1) from2 parabacteroides distasonis atcc 8503 at 1.68 a resolution
Resolution1.68 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   18.20.........30.........40.........50.........60....
Predicted Secondary structure 






















Query SS confidence 














































Query Sequence  LMMKIGVFVPIGNNGWLISTHAPQYMPTFELNKAIVQKAEHYHFDFA
Query Conservation    
  




                        

  

  


  
Alig confidence 







............
















...






Template Conservation    


   ............        
 
 
    ...  




Template Sequence  LELKLSFQ. . . . . . . . . . . . EGIAPGESLNEKLDFXE. . . KLGVVGF
Template Known Secondary structure 


............TTSS

SS...TT

Template Predicted Secondary structure 


............







...



Template SS confidence 














































   4950...... ...60.........70... ......80
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions