Return to main results Retrieve Phyre Job Id

Job DescriptionP75898
Confidence68.19%DateThu Jan 5 12:15:49 GMT 2012
Rank30Aligned Residues29
% Identity28%Templatec2x7vA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:probable endonuclease 4; PDBTitle: crystal structure of thermotoga maritima endonuclease iv in2 the presence of zinc
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1920.........30.........40.........50.........60....
Predicted Secondary structure 





















Query SS confidence 













































Query Sequence  MMKIGVFVPIGNNGWLISTHAPQYMPTFELNKAIVQKAEHYHFDFA
Query Conservation   
  




                        

  

  


  
Alig confidence 












.................















Template Conservation    


        .................
      
   
   
Template Sequence  MIKIGAHMPISKG. . . . . . . . . . . . . . . . . FDRVPQDTVNIGGNSF
Template Known Secondary structure 





TT
.................GGGTT
S
Template Predicted Secondary structure 






.................



Template SS confidence 













































   1........10... ......20.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions