Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8P3
Confidence17.41%DateThu Jan 5 11:08:25 GMT 2012
Rank13Aligned Residues45
% Identity13%Templated1s29a_
SCOP infoDNA/RNA-binding 3-helical bundle "Winged helix" DNA-binding domain La domain
Resolution1.60

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   18.20.........30.........40.........50.........60.........70.........80.......
Predicted Secondary structure 

























Query SS confidence 





































































Query Sequence  DFQLYPGELGKRIYNEISKEAWAQWQHKQTMLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP
Query Conservation    




 

  
   


 

  

  






 


      
 

   
  


       


 
Alig confidence 
















.................



















........







Template Conservation     
        
  

.................





 

  
 

     ........    
 

Template Sequence  SHXPLSSENKQKLQKQV. . . . . . . . . . . . . . . . . EFYFSDVNVQRDIFLKGKXA. . . . . . . . ENAEGFVS
Template Known Secondary structure  TTS


.................TSTT
T........TSTT

Template Predicted Secondary structure 





.................

........





Template SS confidence 





































































   2.......10........ .20.........30........ .40......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions