Return to main results Retrieve Phyre Job Id

Job DescriptionP04425
Confidence66.00%DateThu Jan 5 10:58:17 GMT 2012
Rank133Aligned Residues31
% Identity10%Templatec3ghyA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:ketopantoate reductase protein; PDBTitle: crystal structure of a putative ketopantoate reductase from ralstonia2 solanacearum molk2
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........
Predicted Secondary structure 












Query SS confidence 






































Query Sequence  MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYME
Query Conservation   
 
 
   
        


  
  

   
  
    
Alig confidence 







........






















Template Conservation 



 


........ 
  
   
  
   
  
    
Template Sequence  LTRICIVG. . . . . . . . AGAVGGYLGARLALAGEAINVLA
Template Known Secondary structure 


S........

TT


Template Predicted Secondary structure 


........




Template SS confidence 






































   1....... .10.........20.........30.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions