Return to main results Retrieve Phyre Job Id

Job DescriptionP04425
Confidence20.62%DateThu Jan 5 10:58:17 GMT 2012
Rank223Aligned Residues30
% Identity13%Templatec1ks9A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:2-dehydropantoate 2-reductase; PDBTitle: ketopantoate reductase from escherichia coli
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........
Predicted Secondary structure 











Query SS confidence 





































Query Sequence  IKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYME
Query Conservation 
 
 
   
        


  
  

   
  
    
Alig confidence 






........






















Template Conservation 


 


........ 
 

   
  
   
  
    
Template Sequence  MKITVLG. . . . . . . . CGALGQLWLTALCKQGHEVQGWL
Template Known Secondary structure 

........
STT

Template Predicted Secondary structure 

........




Template SS confidence 





































   1...... ..10.........20.........30
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions