Return to main results Retrieve Phyre Job Id

Job DescriptionP31663
Confidence45.42%DateThu Jan 5 11:48:25 GMT 2012
Rank92Aligned Residues23
% Identity52%Templatec3o6cA_
PDB info PDB header:transferaseChain: A: PDB Molecule:pyridoxine 5'-phosphate synthase; PDBTitle: pyridoxal phosphate biosynthetic protein pdxj from campylobacter2 jejuni
Resolution1.87 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   53......60.........70.........80.........90
Predicted Secondary structure 














Query SS confidence 





































Query Sequence  VSIFVNPMQFDRPEDLARYPRTLQEDCEKLNKRKVDLV
Query Conservation 






 

   

   


 
  
  

   


 
Alig confidence 








...............













Template Conservation 






  ...............
 
  
   


 
Template Sequence  VSLFINPSL. . . . . . . . . . . . . . . EDIEKSKILKAQFI
Template Known Secondary structure 
S
...............TT
S
Template Predicted Secondary structure 


...............


Template SS confidence 





































   124.....130.. .......140......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions