Return to main results Retrieve Phyre Job Id

Job DescriptionP05825
Confidence12.83%DateThu Jan 5 10:58:57 GMT 2012
Rank41Aligned Residues36
% Identity47%Templatec3lkxB_
PDB info PDB header:chaperoneChain: B: PDB Molecule:nascent polypeptide-associated complex subunit alpha; PDBTitle: human nac dimerization domain
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   71........80.........90.........100.........110.........120.........130.........140.........150
Predicted Secondary structure 
















































Query SS confidence 















































































Query Sequence  IRTMPGVNLTGNSTSGQRGNNRQIDIRGMGPENTLILIDGKPVSSRNSVRQGWRGERDTRGDTSWVPPEMIERIEVLRGP
Query Conservation 
   


 
      
  
    
 


       
 


                         
    

 





 
Alig confidence 







..............





..






.................................









Template Conservation 

 
 

 ..............





.. 
  


.................................
  






Template Sequence  LRQVTGVT. . . . . . . . . . . . . . RVTIRK. . SKNILFV. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ITKPDVYKSP
Template Known Secondary structure 




................TTT.................................S

T
Template Predicted Secondary structure 



................

.................................




Template SS confidence 















































































   26...30... ...... 40...... ...50......
 
   151....
Predicted Secondary structure 


Query SS confidence 




Query Sequence  AAARY
Query Conservation   

 
Alig confidence 




Template Conservation   
 

Template Sequence  ASDTY
Template Known Secondary structure  TSS
Template Predicted Secondary structure 


Template SS confidence 




   57..60.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions