Return to main results Retrieve Phyre Job Id

Job DescriptionP05825
Confidence3.82%DateThu Jan 5 10:58:57 GMT 2012
Rank78Aligned Residues27
% Identity19%Templatec2vc8A_
PDB info PDB header:protein-bindingChain: A: PDB Molecule:enhancer of mrna-decapping protein 3; PDBTitle: crystal structure of the lsm domain of human edc3 (enhancer2 of decapping 3)
Resolution1.31 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   109110.........120.........130.........140.........150.
Predicted Secondary structure 






























Query SS confidence 










































Query Sequence  DGKPVSSRNSVRQGWRGERDTRGDTSWVPPEMIERIEVLRGPA
Query Conservation 

                         
    

 





  
Alig confidence 









................
















Template Conservation 



    

................

 
 

  



    
Template Sequence  NGVKCLVPEV. . . . . . . . . . . . . . . . TFRAGDITELKILEIPG
Template Known Secondary structure  TT
SSS................GGG
S


Template Predicted Secondary structure 






................





Template SS confidence 










































   43......50.. .......60.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions