Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9R2
Confidence10.22%DateThu Jan 5 11:11:03 GMT 2012
Rank7Aligned Residues23
% Identity30%Templated2qjza1
SCOP infoCH domain-like Calponin-homology domain, CH-domain Calponin-homology domain, CH-domain
Resolution1.25

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.....
Predicted Secondary structure 


Query SS confidence 

































Query Sequence  KSMDKLTTGVAYGTSAGSAGYWFLQLLDKVTPSQ
Query Conservation 
  

 

 



 



  
     

  

 
Alig confidence 












...........









Template Conservation   


 
  




...........

 
 
 

 
Template Sequence  TKIEQLCSGAAYC. . . . . . . . . . . QFXDXLFPGS
Template Known Secondary structure 

GGGGGGS...........STTS
Template Predicted Secondary structure 




...........







Template SS confidence 

































   33......40..... ....50.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions