Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADX1
Confidence2.23%DateThu Jan 5 11:22:01 GMT 2012
Rank68Aligned Residues24
% Identity33%Templatec3lf4A_
PDB info PDB header:fluorescent proteinChain: A: PDB Molecule:fluorescent timer precursor blue102; PDBTitle: crystal structure of fluorescent timer precursor blue102
Resolution1.81 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.
Predicted Secondary structure 













Query SS confidence 






























Query Sequence  MQARVKWVEGLTFLGESASGHQILMDGNSGD
Query Conservation 

  
   
          
  
  
 

  
Alig confidence 








.......














Template Conservation 

    
 
.......




 
   
 
 
Template Sequence  MRFKVHMEG. . . . . . . SVNGHEFEIEGEGEG
Template Known Secondary structure  .......TT
Template Predicted Secondary structure  .......





Template SS confidence 






























   12.......20 .........30.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions