Return to main results Retrieve Phyre Job Id

Job DescriptionP00904
Confidence23.75%DateWed Jan 25 15:20:09 GMT 2012
Rank436Aligned Residues45
% Identity22%Templatec3lgbB_
PDB info PDB header:transferaseChain: B: PDB Molecule:dna primase large subunit; PDBTitle: crystal structure of the fe-s domain of the yeast dna primase
Resolution1.54 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   197..200.........210.........220.........230.........240.........250........
Predicted Secondary structure 















Query SS confidence 





























































Query Sequence  ANTLQPILEKLYQAQTLSQQESHQLFSAVVRGELKPEQLAAALVSMKIRGEHPNEIAGAATA
Query Conservation         
 
   
  

 


      

 
     





 


 



 


 
   
Alig confidence 























..............







...












Template Conservation 



  
   
    

 
  
 
..............
 



 
...

  

 
 
 
 
Template Sequence  PLCIKNLXEGLKKNHHLRYYGRQQ. . . . . . . . . . . . . . LSLFLKGI. . . GLSADEALKFWSE
Template Known Secondary structure 
S


..............T...T

Template Predicted Secondary structure 






..............
...


Template SS confidence 





























































   334.....340.........350....... ..360..... ....370........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions