Return to main results Retrieve Phyre Job Id

Job DescriptionP00904
Confidence54.56%DateWed Jan 25 15:20:09 GMT 2012
Rank301Aligned Residues40
% Identity20%Templatec3izcK_
PDB info PDB header:ribosomeChain: K: PDB Molecule:60s ribosomal protein rpl16 (l13p); PDBTitle: localization of the large subunit ribosomal proteins into a 6.1 a2 cryo-em map of saccharomyces cerevisiae translating 80s ribosome
ResolutionNULL Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.... .....30.........40.........50......
Predicted Secondary structure 






...
















Query SS confidence 























. . .































Query Sequence  MADILLLDNIDSFTYNLADQLRSN. . . GHNVVIYRNHIPAQTLIERLATMSNPVLMLSP
Query Conservation 
  




  


   
   
   ...
  
 
   
         
       




Alig confidence 























...






................








Template Conservation      




   






 


 

 

 



................




 


Template Sequence  VEPVVVIDGKGHLVGRLASVVAKQLLNGQKIVVV. . . . . . . . . . . . . . . . RAEELNISG
Template Known Secondary structure  SSS


TTBBTT

................
GGG
S
Template Predicted Secondary structure 









................



Template SS confidence 


























































   3......10.........20.........30...... ...40.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions