Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAQ6
Confidence7.38%DateThu Jan 5 11:13:31 GMT 2012
Rank41Aligned Residues61
% Identity13%Templatec3p6yD_
PDB info PDB header:rna binding protein/rnaChain: D: PDB Molecule:cleavage and polyadenylation specificity factor subunit 6; PDBTitle: cf im25-cf im68-uguaa complex
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   23......30.........40.........50.........60.........70.........80.........90.........100..
Predicted Secondary structure 




































Query SS confidence 















































































Query Sequence  AAKAAPLFKEFGALRIVECWASDVPDGKVTDFRMAVKAEENEEVVFSWIEYPSKEVRDAANQKMMSDPRMKEFGESMPFD
Query Conservation 
  
  
  
 


  

 
 



 
  
 
  

 
   







 




 


   


 


         

Alig confidence 






















.............























...........








Template Conservation     
   
   
           .............        
 


 
    
  
 ...........  


    
Template Sequence  DEDLTEAVHSLGVNDILEIKFFE. . . . . . . . . . . . . NRANGQSKGFALVGVSEASSKKLM. . . . . . . . . . . DLLPKRELH
Template Known Secondary structure  T





.............
TTT



...........GGGS
BT
Template Predicted Secondary structure 





.............







...........




Template SS confidence 















































































   94.....100.........110...... ...120.........130.........140 .........
 
   103....
Predicted Secondary structure 
Query SS confidence 




Query Sequence  GKRMI
Query Conservation 




Alig confidence 




Template Conservation 

 
 
Template Sequence  GQNPV
Template Known Secondary structure  TB

Template Predicted Secondary structure 
Template SS confidence 




   151....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions