Return to main results Retrieve Phyre Job Id

Job DescriptionP37615
Confidence4.01%DateThu Jan 5 11:55:51 GMT 2012
Rank70Aligned Residues27
% Identity30%Templated2j0sc1
SCOP infoMago nashi protein Mago nashi protein Mago nashi protein
Resolution2.21

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   71........80.........90.........100.......
Predicted Secondary structure 













Query SS confidence 




































Query Sequence  RYEASFKPQSGGMEQTFRLDAQQYHALTVGDKGTLSY
Query Conservation   





    
   

 
    
  
 


 
 

 
Alig confidence 



















..........






Template Conservation 


 

 
  
 





  ..........  
 


Template Sequence  RYYVGHKGKFGHEFLEFEFR. . . . . . . . . . PDGKLRY
Template Known Secondary structure  TT
..........TTS
Template Predicted Secondary structure 








..........



Template SS confidence 




































   8.10.........20....... ..30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions