Return to main results Retrieve Phyre Job Id

Job DescriptionP37615
Confidence4.64%DateThu Jan 5 11:55:51 GMT 2012
Rank56Aligned Residues33
% Identity24%Templatec3tekA_
PDB info PDB header:dna binding proteinChain: A: PDB Molecule:thermodbp-single stranded dna binding protein; PDBTitle: thermodbp: a non-canonical single-stranded dna binding protein with a2 novel structure and mechanism
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20... ......30.......
Predicted Secondary structure 

........................





Query SS confidence 


















. . . . . . . . . . . . . . . . . . . . . . . .













Query Sequence  PLFFIVIIGLIVVAASFRF. . . . . . . . . . . . . . . . . . . . . . . . MQQRREKADNDMAP
Query Conservation 

 



  


      
........................         
  

Alig confidence 


















........................













Template Conservation 











 



 

  

  

 




 

 
 

 

 

 





  
Template Sequence  PEFFKLLFGAVAGSLREQFGPDGENIFNRIRDSEKFRETSRELFDGLKKWFFEEAVP
Template Known Secondary structure 
TTTTTST
Template Predicted Secondary structure 


Template SS confidence 
























































   50.........60.........70.........80.........90.........100......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions