Return to main results Retrieve Phyre Job Id

Job DescriptionP24242
Confidence89.77%DateWed Jan 25 15:20:45 GMT 2012
Rank388Aligned Residues30
% Identity27%Templated1lj9a_
SCOP infoDNA/RNA-binding 3-helical bundle "Winged helix" DNA-binding domain MarR-like transcriptional regulators
Resolution1.60

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40......
Predicted Secondary structure 














Query SS confidence 












































Query Sequence  TTMLEVAKRAGVSKATVSRVLSGNGYVSQETKDRVFQAVEESGYR
Query Conservation   

 


  



  






    

  

 

     



 
Alig confidence 






















...............






Template Conservation   
  


  
 
   


  
  ...............
   
 
Template Sequence  IIQEKIAELIKVDRTTAARAIKR. . . . . . . . . . . . . . . LEEQGFI
Template Known Secondary structure  T

...............TTS
Template Predicted Secondary structure 




...............
Template SS confidence 












































   45....50.........60....... ..70....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions