Return to main results Retrieve Phyre Job Id

Job DescriptionP24242
Confidence86.29%DateWed Jan 25 15:20:45 GMT 2012
Rank459Aligned Residues28
% Identity32%Templated1l3la1
SCOP infoDNA/RNA-binding 3-helical bundle C-terminal effector domain of the bipartite response regulators GerE-like (LuxR/UhpA family of transcriptional regulators)
Resolution1.66

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40....
Predicted Secondary structure 











Query SS confidence 









































Query Sequence  TMLEVAKRAGVSKATVSRVLSGNGYVSQETKDRVFQAVEESG
Query Conservation 

 


  



  






    

  

 

     


Alig confidence 















..............











Template Conservation 
   

  
 

  

..............      
  


Template Sequence  TXEEIADVEGVKYNSV. . . . . . . . . . . . . . RVKLREAXKRFD
Template Known Secondary structure 
T

..............T
Template Predicted Secondary structure 



..............
Template SS confidence 









































   190.........200..... ....210.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions