Return to main results Retrieve Phyre Job Id

Job DescriptionP24242
Confidence92.16%DateWed Jan 25 15:20:45 GMT 2012
Rank264Aligned Residues31
% Identity35%Templatec3cwrA_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:transcriptional regulator, tetr family; PDBTitle: crystal structure of transcriptional regulator of tetr2 family (yp_425770.1) from rhodospirillum rubrum atcc 111703 at 1.50 a resolution
Resolution1.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40
Predicted Secondary structure 











Query SS confidence 






































Query Sequence  TTMLEVAKRAGVSKATVSRVLSGNGYVSQETKDRVFQAV
Query Conservation   

 


  



  






    

  

 

    
Alig confidence 






















........







Template Conservation   

  

  



  


  
 
........
  
  
 
Template Sequence  XTXEGVASEAGIAKKTLYRFASG. . . . . . . . RADLIGLL
Template Known Secondary structure 

T


SS........
Template Predicted Secondary structure 







........
Template SS confidence 






































   37..40.........50......... 60.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions