Return to main results Retrieve Phyre Job Id

Job DescriptionP24242
Confidence82.69%DateWed Jan 25 15:20:45 GMT 2012
Rank496Aligned Residues29
% Identity17%Templatec1p4xA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:staphylococcal accessory regulator a homologue; PDBTitle: crystal structure of sars protein from staphylococcus aureus
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40......
Predicted Secondary structure 













Query SS confidence 











































Query Sequence  TMLEVAKRAGVSKATVSRVLSGNGYVSQETKDRVFQAVEESGYR
Query Conservation 

 


  



  






    

  

 

     



 
Alig confidence 





















...............






Template Conservation     

           
  
  ...............
   


Template Sequence  LLKDLIETIHHKYPQTVRALNN. . . . . . . . . . . . . . . LKKQGYL
Template Known Secondary structure  SSS
...............TSS
Template Predicted Secondary structure 





...............


Template SS confidence 











































   176...180.........190....... ..200....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions