Return to main results Retrieve Phyre Job Id

Job DescriptionP75971
Confidence0.87%DateThu Jan 5 12:16:39 GMT 2012
Rank90Aligned Residues37
% Identity30%Templatec1tmxA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:hydroxyquinol 1,2-dioxygenase; PDBTitle: crystal structure of hydroxyquinol 1,2-dioxygenase from2 nocardioides simplex 3e
Resolution1.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20.........30..... ....40...
Predicted Secondary structure 





















..............




Query SS confidence 




























. . . . . . . . . . . . . .







Query Sequence  RTRVKVEADNRPSVDTHPPGVQPSPGTGG. . . . . . . . . . . . . . TRHHNFML
Query Conservation 




























..............





 
Alig confidence 




























..............







Template Conservation 

   

  
 
 
 

 

 



 


 
 

   


  






 
Template Sequence  RAHLLSGPDGGYAFWAITPTPYPIPHDGPVGRMLAATGRSPMRASHLHFMV
Template Known Secondary structure 

TTS






SSTT




Template Predicted Secondary structure 






















Template SS confidence 


















































   176...180.........190.........200.........210.........220......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions