Return to main results Retrieve Phyre Job Id

Job DescriptionP0AD35
Confidence3.54%DateThu Jan 5 11:19:51 GMT 2012
Rank29Aligned Residues34
% Identity21%Templatec3tbiB_
PDB info PDB header:transcriptionChain: B: PDB Molecule:dna-directed rna polymerase subunit beta; PDBTitle: crystal structure of t4 gp33 bound to e. coli rnap beta-flap domain
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   75....80.........90.........100.........110.........
Predicted Secondary structure 


























Query SS confidence 












































Query Sequence  SKLREKWDELSLRLSPSVSTYTEKREDPYFKASYDNVDYSQIPAG
Query Conservation   


 
 
 
  
 
        
             
  
 
  
Alig confidence 


























...........






Template Conservation    
     
 
  
    
 

 

 
...........






Template Sequence  EQLAEQYDELKHEFEKKLEAKRRKITQ. . . . . . . . . . . GDDLAPG
Template Known Secondary structure  S...........
B


TT
Template Predicted Secondary structure 
...........






Template SS confidence 












































   1012.......1020.........1030........ .1040.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions