Return to main results Retrieve Phyre Job Id

Job DescriptionP0AD35
Confidence2.29%DateThu Jan 5 11:19:51 GMT 2012
Rank59Aligned Residues25
% Identity16%Templatec3cxmA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:uracil-dna glycosylase; PDBTitle: leishmania naiffi uracil-dna glycosylase in complex with 5-bromouracil
Resolution1.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20.........30........
Predicted Secondary structure 










Query SS confidence 































Query Sequence  LWKKIIALYEQAAECDGEVVRPKEPNWTAWAN
Query Conservation 
   
    
 
    
     



   


Alig confidence 











.......












Template Conservation 
 


  
    .......  
  
 
  

 
Template Sequence  IYKELTTDIAGF. . . . . . . QAPKHGYLQSWSE
Template Known Secondary structure  STT
.......


SS


T
Template Predicted Secondary structure 



.......






Template SS confidence 































   234.....240..... ....250........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions