Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADF6
Confidence20.51%DateThu Jan 5 11:20:54 GMT 2012
Rank64Aligned Residues35
% Identity17%Templatec3gmiA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:upf0348 protein mj0951; PDBTitle: crystal structure of a protein of unknown function from2 methanocaldococcus jannaschii
Resolution1.91 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   55....60.... .....70.........80.........
Predicted Secondary structure 
...............











Query SS confidence 









. . . . . . . . . . . . . . .
























Query Sequence  EDKASLKSML. . . . . . . . . . . . . . . RNNIAIITSYNDMLSAHQPYEHYPE
Query Conservation         
  ...............

 


 

  
  
 
 

  

 
Alig confidence 









...............
























Template Conservation                            















 
 




Template Sequence  AKRKDEKSFKDFKKIVEEIKERENKDKIVCDFTEYNPLHKGHKYALEKGK
Template Known Secondary structure 


T





TT

Template Predicted Secondary structure 











Template SS confidence 

















































   25....30.........40.........50.........60.........70....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions